ROR1 (NM_001083592) Human Recombinant Protein

ROR1 protein,

Recombinant protein of human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2

Product Info Summary

SKU: PROTQ01973
Size: 20 µg
Source: HEK293T

Product Name

ROR1 (NM_001083592) Human Recombinant Protein

View all ROR1 recombinant proteins

SKU/Catalog Number

PROTQ01973

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ROR1 (NM_001083592) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ01973)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

43.6 kDa

Amino Acid Sequence

MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK

Validation Images & Assay Conditions

Gene/Protein Information For ROR1 (Source: Uniprot.org, NCBI)

Gene Name

ROR1

Full Name

Inactive tyrosine-protein kinase transmembrane receptor ROR1

Weight

43.6 kDa

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.10.1; MGC99659; neurotrophic tyrosine kinase receptor-related 1; Neurotrophic tyrosine kinase, receptor-related 1; NTRKR1; NTRKR1dJ537F10.1; receptor tyrosine kinase-like orphan receptor 1; ROR1; tyrosine-protein kinase transmembrane receptor ROR1 ROR1 NTRKR1, dJ537F10.1 receptor tyrosine kinase like orphan receptor 1 inactive tyrosine-protein kinase transmembrane receptor ROR1|neurotrophic tyrosine kinase, receptor-related 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ROR1, check out the ROR1 Infographic

ROR1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ROR1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ01973

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ROR1 (NM_001083592) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ROR1 (NM_001083592) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ROR1 (NM_001083592) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ01973
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.