ROMO1 (NM_080748) Human Recombinant Protein

Romo1 protein,

Recombinant protein of human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTP60602
Size: 20 µg
Source: HEK293T

Product Name

ROMO1 (NM_080748) Human Recombinant Protein

View all Romo1 recombinant proteins

SKU/Catalog Number

PROTP60602

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ROMO1 (NM_080748) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP60602)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8 kDa

Amino Acid Sequence

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC

Validation Images & Assay Conditions

Gene/Protein Information For ROMO1 (Source: Uniprot.org, NCBI)

Gene Name

ROMO1

Full Name

Reactive oxygen species modulator 1

Weight

8 kDa

Superfamily

MGR2 family

Alternative Names

reactive oxygen species modulator 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ROMO1, check out the ROMO1 Infographic

ROMO1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ROMO1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP60602

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ROMO1 (NM_080748) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ROMO1 (NM_080748) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ROMO1 (NM_080748) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP60602
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.