RO60 (NM_001042370) Human Recombinant Protein

RO60 protein,

Product Info Summary

SKU: PROTP10155
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RO60 (NM_001042370) Human Recombinant Protein

View all RO60 recombinant proteins

SKU/Catalog Number

PROTP10155

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human TROVE domain family, member 2 (TROVE2), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RO60 (NM_001042370) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP10155)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

60 kDa

Amino Acid Sequence

MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI

Validation Images & Assay Conditions

Gene/Protein Information For RO60 (Source: Uniprot.org, NCBI)

Gene Name

RO60

Full Name

60 kDa SS-A/Ro ribonucleoprotein

Weight

60 kDa

Superfamily

Ro 60 kDa family

Alternative Names

60 kDa SS-A/Ro ribonucleoprotein RO60 RORNP, SSA2, TROVE2 Ro60, Y RNA binding protein 60 kDa SS-A/Ro ribonucleoprotein|60 kDa ribonucleoprotein Ro|Ro/SSA 60kDa|Sjogren syndrome A2 (60kD, ribonucleoprotein auto SS-A/Ro)|TROVE domain family member 2|gastric cancer multi-drug resistance protein|ro60 auto|sjoegren syndrome type A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RO60, check out the RO60 Infographic

RO60 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RO60: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP10155

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RO60 (NM_001042370) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RO60 (NM_001042370) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RO60 (NM_001042370) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP10155
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.