RNF14 (NM_004290) Human Recombinant Protein

ARA54 protein,

Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 1

Product Info Summary

SKU: PROTQ9UBS8
Size: 20 µg
Source: HEK293T

Product Name

RNF14 (NM_004290) Human Recombinant Protein

View all ARA54 recombinant proteins

SKU/Catalog Number

PROTQ9UBS8

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RNF14 (NM_004290) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UBS8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

53.7 kDa

Amino Acid Sequence

MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED

Validation Images & Assay Conditions

Gene/Protein Information For RNF14 (Source: Uniprot.org, NCBI)

Gene Name

RNF14

Full Name

E3 ubiquitin-protein ligase RNF14

Weight

53.7 kDa

Superfamily

RBR family

Alternative Names

Androgen receptor-associated protein 54; ARA54; ARA54androgen receptor associated protein 54; EC 6.3.2.-; HFB30; HFB30E3 ubiquitin-protein ligase RNF14; ring finger protein 14FLJ26004; RNF14; Triad2 protein; TRIAD2 RNF14 ARA54, HFB30, HRIHFB2038, TRIAD2 ring finger protein 14 E3 ubiquitin-protein ligase RNF14|androgen receptor associated protein 54

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RNF14, check out the RNF14 Infographic

RNF14 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RNF14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UBS8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RNF14 (NM_004290) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RNF14 (NM_004290) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RNF14 (NM_004290) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UBS8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.