RIZ1 (PRDM2) (NM_001135610) Human Recombinant Protein

PRDM2 protein,

Recombinant protein of human PR domain containing 2, with ZNF domain (PRDM2), transcript variant 4

Product Info Summary

SKU: PROTQ13029
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RIZ1 (PRDM2) (NM_001135610) Human Recombinant Protein

View all PRDM2 recombinant proteins

SKU/Catalog Number

PROTQ13029

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human PR domain containing 2, with ZNF domain (PRDM2), transcript variant 4

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RIZ1 (PRDM2) (NM_001135610) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13029)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.3 kDa

Amino Acid Sequence

MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKATASAWRPDALHQRPRTSPGSIGRSKLQLQPSSRDHSSKSRHSGCSLTAPEVTWNQ

Validation Images & Assay Conditions

Gene/Protein Information For PRDM2 (Source: Uniprot.org, NCBI)

Gene Name

PRDM2

Full Name

PR domain zinc finger protein 2

Weight

25.3 kDa

Superfamily

class V-like SAM-binding methyltransferase superfamily

Alternative Names

PR domain zinc finger protein 2 PRDM2 HUMHOXY1, KMT8, KMT8A, MTB-ZF, RIZ, RIZ1, RIZ2 PR/SET domain 2 PR domain zinc finger protein 2|GATA-3 binding protein G3B|MTE-binding protein|PR domain 2|PR domain containing 2, with ZNF domain|PR domain-containing protein 2|lysine N-methyltransferase 8|retinoblastoma protein-binding zinc finger protein|retinoblastoma protein-interacting zinc finger protein|zinc finger protein RIZ|zinc-finger DNA-binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRDM2, check out the PRDM2 Infographic

PRDM2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRDM2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13029

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RIZ1 (PRDM2) (NM_001135610) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RIZ1 (PRDM2) (NM_001135610) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RIZ1 (PRDM2) (NM_001135610) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13029
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.