RHOJ (NM_020663) Human Recombinant Protein

RHOJ protein,

Recombinant protein of human ras homolog gene family, member J (RHOJ)

Product Info Summary

SKU: PROTQ9H4E5
Size: 20 µg
Source: HEK293T

Product Name

RHOJ (NM_020663) Human Recombinant Protein

View all RHOJ recombinant proteins

SKU/Catalog Number

PROTQ9H4E5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ras homolog gene family, member J (RHOJ)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RHOJ (NM_020663) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H4E5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.6 kDa

Amino Acid Sequence

MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII

Validation Images & Assay Conditions

Gene/Protein Information For RHOJ (Source: Uniprot.org, NCBI)

Gene Name

RHOJ

Full Name

Rho-related GTP-binding protein RhoJ

Weight

23.6 kDa

Superfamily

small GTPase superfamily

Alternative Names

ARHJTC10B; FLJ14445; ras homolog gene family, member J; RASL7B; Ras-like protein family member 7B; RAS-like, family 7, member B; RHOI; rho-related GTP-binding protein RhoJ; Tc10-like GTP-binding protein; TC10-like Rho GTPase; TCLMGC34777 RHOJ ARHJ, RASL7B, TC10B, TCL ras homolog family member J rho-related GTP-binding protein RhoJ|RAS-like, family 7, member B|TC10-like Rho GTPase|ras homolog gene family, member J|ras-like protein family member 7B|tc10-like GTP-binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RHOJ, check out the RHOJ Infographic

RHOJ infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RHOJ: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H4E5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RHOJ (NM_020663) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RHOJ (NM_020663) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RHOJ (NM_020663) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H4E5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.