RHOB (NM_004040) Human Recombinant Protein

RHOB protein,

Product Info Summary

SKU: PROTP62745
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RHOB (NM_004040) Human Recombinant Protein

View all RHOB recombinant proteins

SKU/Catalog Number

PROTP62745

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ras homolog gene family, member B (RHOB)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RHOB (NM_004040) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP62745)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.9 kDa

Amino Acid Sequence

MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL

Validation Images & Assay Conditions

Gene/Protein Information For RHOB (Source: Uniprot.org, NCBI)

Gene Name

RHOB

Full Name

Rho-related GTP-binding protein RhoB

Weight

21.9 kDa

Superfamily

small GTPase superfamily

Alternative Names

ARH6MSTP081; ARHBAplysia RAS-related homolog 6; h6; MST081; oncogene RHO H6; ras homolog gene family, member B; Rho cDNA clone 6; RHOH6RhoB; rho-related GTP-binding protein RhoB RHOB ARH6, ARHB, MST081, MSTP081, RHOH6 ras homolog family member B rho-related GTP-binding protein RhoB|Aplysia RAS-related homolog 6|h6|oncogene RHO H6|ras homolog gene family, member B|rho cDNA clone 6

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RHOB, check out the RHOB Infographic

RHOB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RHOB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP62745

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RHOB (NM_004040) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RHOB (NM_004040) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RHOB (NM_004040) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP62745
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.