RFC3 (NM_002915) Human Recombinant Protein

RFC3 protein,

Recombinant protein of human replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 1

Product Info Summary

SKU: PROTP40938
Size: 20 µg
Source: HEK293T

Product Name

RFC3 (NM_002915) Human Recombinant Protein

View all RFC3 recombinant proteins

SKU/Catalog Number

PROTP40938

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RFC3 (NM_002915) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP40938)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40.4 kDa

Amino Acid Sequence

MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF

Validation Images & Assay Conditions

Gene/Protein Information For RFC3 (Source: Uniprot.org, NCBI)

Gene Name

RFC3

Full Name

Replication factor C subunit 3

Weight

40.4 kDa

Superfamily

activator 1 small subunits family

Alternative Names

A1 38 kDa subunit; Activator 1 38 kDa subunit; Activator 1 subunit 3; MGC5276; replication factor C (activator 1) 3 (38kD); replication factor C (activator 1) 3, 38kDa; Replication factor C 38 kDa subunit; replication factor C subunit 3; RFC, 38 kD subunit; RFC38RF-C 38 kDa subunit RFC3 RFC38 replication factor C subunit 3 replication factor C subunit 3|A1 38 kDa subunit|RF-C 38 kDa subunit|RFC, 38 kD subunit|activator 1 38 kDa subunit|activator 1 subunit 3|replication factor C (activator 1) 3, 38kDa|replication factor C 38 kDa subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RFC3, check out the RFC3 Infographic

RFC3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RFC3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP40938

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RFC3 (NM_002915) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RFC3 (NM_002915) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RFC3 (NM_002915) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP40938
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.