REEP5 (NM_005669) Human Recombinant Protein

REEP5 protein,

Recombinant protein of human receptor accessory protein 5 (REEP5)

Product Info Summary

SKU: PROTQ00765
Size: 20 µg
Source: HEK293T

Product Name

REEP5 (NM_005669) Human Recombinant Protein

View all REEP5 recombinant proteins

SKU/Catalog Number

PROTQ00765

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human receptor accessory protein 5 (REEP5)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

REEP5 (NM_005669) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ00765)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.3 kDa

Amino Acid Sequence

MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Validation Images & Assay Conditions

Gene/Protein Information For REEP5 (Source: Uniprot.org, NCBI)

Gene Name

REEP5

Full Name

Receptor expression-enhancing protein 5

Weight

21.3 kDa

Superfamily

DP1 family

Alternative Names

C5orf18polyposis coli region hypothetical protein DP1; chromosome 5 open reading frame 18; D5S346deleted in polyposis 1; DP1TB2YOP1; MGC70440; Polyposis locus protein 1; Protein TB2; receptor accessory protein 5; receptor expression enhancing protein 5; receptor expression-enhancing protein 5 REEP5 C5orf18, D5S346, DP1, POB16, TB2, YOP1, Yip2e receptor accessory protein 5 receptor expression-enhancing protein 5|deleted in polyposis 1|polyposis coli region hypothetical protein DP1|polyposis locus protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on REEP5, check out the REEP5 Infographic

REEP5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for REEP5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ00765

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used REEP5 (NM_005669) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For REEP5 (NM_005669) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for REEP5 (NM_005669) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ00765
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.