RC74 (INTS9) (NM_018250) Human Recombinant Protein

RC74 protein,

Recombinant protein of human integrator complex subunit 9 (INTS9), transcript variant 1

Product Info Summary

SKU: PROTQ9NV88
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RC74 (INTS9) (NM_018250) Human Recombinant Protein

View all RC74 recombinant proteins

SKU/Catalog Number

PROTQ9NV88

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human integrator complex subunit 9 (INTS9), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RC74 (INTS9) (NM_018250) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NV88)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

73.6 kDa

Amino Acid Sequence

MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTVQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCYPSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF

Validation Images & Assay Conditions

Gene/Protein Information For INTS9 (Source: Uniprot.org, NCBI)

Gene Name

INTS9

Full Name

Integrator complex subunit 9

Weight

73.6 kDa

Superfamily

metallo-beta-lactamase superfamily

Alternative Names

CPSF2L; FLJ10871; INT9; integrator complex subunit 9; Protein related to CPSF subunits of 74 kDa; RC74; RC-74 INTS9 CPSF2L, INT9, RC74 integrator complex subunit 9 integrator complex subunit 9|protein related to CPSF subunits of 74 kDa

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on INTS9, check out the INTS9 Infographic

INTS9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for INTS9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NV88

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RC74 (INTS9) (NM_018250) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RC74 (INTS9) (NM_018250) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RC74 (INTS9) (NM_018250) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NV88
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.