RBP1 (NM_002899) Human Recombinant Protein

Retinol Binding Protein RBP protein,

Product Info Summary

SKU: PROTP09455
Size: 20 µg
Source: HEK293T

Product Name

RBP1 (NM_002899) Human Recombinant Protein

View all Retinol Binding Protein RBP recombinant proteins

SKU/Catalog Number

PROTP09455

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human retinol binding protein 1, cellular (RBP1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RBP1 (NM_002899) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09455)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.7 kDa

Amino Acid Sequence

MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ

Validation Images & Assay Conditions

Gene/Protein Information For RBP1 (Source: Uniprot.org, NCBI)

Gene Name

RBP1

Full Name

Retinol-binding protein 1

Weight

15.7 kDa

Superfamily

calycin superfamily

Alternative Names

C; Cellular retinol-binding protein; CRABP-I; CRBP1CRBP-I; CRBPCellular retinol-binding protein I; CRBPI; RBPC; retinol binding protein 1, cellular; retinol-binding protein 1; retinol-binding protein 1, cellular RBP1 CRABP-I, CRBP, CRBP1, CRBPI, RBPC retinol binding protein 1 retinol-binding protein 1|CRBP-I|cellular retinol binding protein 1|cellular retinol-binding protein I|retinol-binding protein 1, cellular

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RBP1, check out the RBP1 Infographic

RBP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RBP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP09455

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RBP1 (NM_002899) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RBP1 (NM_002899) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RBP1 (NM_002899) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP09455
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.