RbAp46 (RBBP7) (NM_002893) Human Recombinant Protein

RbAp46 protein,

Recombinant protein of human retinoblastoma binding protein 7 (RBBP7)

Product Info Summary

SKU: PROTQ16576
Size: 20 µg
Source: HEK293T

Product Name

RbAp46 (RBBP7) (NM_002893) Human Recombinant Protein

View all RbAp46 recombinant proteins

SKU/Catalog Number

PROTQ16576

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human retinoblastoma binding protein 7 (RBBP7)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RbAp46 (RBBP7) (NM_002893) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16576)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

47.6 kDa

Amino Acid Sequence

MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS

Validation Images & Assay Conditions

Gene/Protein Information For RBBP7 (Source: Uniprot.org, NCBI)

Gene Name

RBBP7

Full Name

Histone-binding protein RBBP7

Weight

47.6 kDa

Superfamily

WD repeat RBAP46/RBAP48/MSI1 family

Alternative Names

G1/S transition control protein-binding protein RbAp46; Histone acetyltransferase type B subunit 2; histone-binding protein RBBP7; MGC138867; Nucleosome-remodeling factor subunit RBAP46; RbAp46; RBBP-7; retinoblastoma binding protein 7; Retinoblastoma-binding protein 7MGC138868; Retinoblastoma-binding protein p46; retinoblastoma-binding protein RbAp46 RBBP7 RbAp46 RB binding protein 7, chromatin remodeling factor histone-binding protein RBBP7|G1/S transition control protein-binding protein RbAp46|RBBP-7|histone acetyltransferase type B subunit 2|nucleosome-remodeling factor subunit RBAP46|retinoblastoma-binding protein 7|retinoblastoma-binding protein RbAp46|retinoblastoma-binding protein p46

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RBBP7, check out the RBBP7 Infographic

RBBP7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RBBP7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16576

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RbAp46 (RBBP7) (NM_002893) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RbAp46 (RBBP7) (NM_002893) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RbAp46 (RBBP7) (NM_002893) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16576
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.