RAPH1 (NM_203365) Human Recombinant Protein

RAPH1 protein,

Recombinant protein of human Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 (RAPH1), transcript variant 3

Product Info Summary

SKU: PROTQ70E73
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RAPH1 (NM_203365) Human Recombinant Protein

View all RAPH1 recombinant proteins

SKU/Catalog Number

PROTQ70E73

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 (RAPH1), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RAPH1 (NM_203365) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ70E73)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

72.7 kDa

Amino Acid Sequence

MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKATQKLPVSRHTLKHGTLKGLSSSSNRIAKPSHASYSLDDVTAQLEQASLSMDEAAQQSVLEDTKPLVTNQHRRTASAGTVSDAEVHSISNSSHSSITSAASSMDSLDIDKVTRPQELDLTHQGQPITEHAISLRCSSKQAKRHIDFTEEQAELTPHSYLDRETSLLLRNIAGKPSHLLTKEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRTESAYDWTSLSSSSIKSGSSSSSIPESQSNHSNQSDSGVSDTQPAGHVRSQSIVSSVFSEAWKRGTQLEESSK

Validation Images & Assay Conditions

Gene/Protein Information For RAPH1 (Source: Uniprot.org, NCBI)

Gene Name

RAPH1

Full Name

Ras-associated and pleckstrin homology domains-containing protein 1

Weight

72.7 kDa

Superfamily

MRL family

Alternative Names

candidate 18; candidate 9; lamellipodin; PREL2; PREL-2; proline rich EVH1 ligand 2; Protein RMO1; Ras association (RalGDS/AF-6) and pleckstrin homology domains 1; ras-associated and pleckstrin homology domains-containing protein 1; RMO1 RAPH1 ALS2CR18, ALS2CR9, LPD, PREL-2, PREL2, RMO1, RalGDS/AF-6 Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 ras-associated and pleckstrin homology domains-containing protein 1|amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 18|amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 9|lamellipodin|proline-rich EVH1 ligand 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RAPH1, check out the RAPH1 Infographic

RAPH1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RAPH1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ70E73

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RAPH1 (NM_203365) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RAPH1 (NM_203365) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RAPH1 (NM_203365) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ70E73
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.