RAIDD (CRADD) (NM_003805) Human Recombinant Protein

RAIDD/CRADD protein,

Product Info Summary

SKU: PROTP78560
Size: 20 µg
Source: HEK293T

Product Name

RAIDD (CRADD) (NM_003805) Human Recombinant Protein

View all RAIDD/CRADD recombinant proteins

SKU/Catalog Number

PROTP78560

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CASP2 and RIPK1 domain containing adaptor with death domain (CRADD)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RAIDD (CRADD) (NM_003805) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP78560)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.6 kDa

Amino Acid Sequence

MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE

Validation Images & Assay Conditions

Gene/Protein Information For CRADD (Source: Uniprot.org, NCBI)

Gene Name

CRADD

Full Name

Death domain-containing protein CRADD

Weight

22.6 kDa

Alternative Names

CASP2 and RIPK1 domain containing adaptor with death domain; Caspase and RIP adapter with death domain; caspase and RIP adaptor with death domain; CRADD; death domain containing protein CRADD; death domain-containing protein CRADD; MGC9163; RAIDD; RAIDDdeath adaptor molecule RAIDD; RIP-associated ICH1/CED3-homologous protein with death domain; RIP-associated protein with a death domain CRADD MRT34, RAIDD CASP2 and RIPK1 domain containing adaptor with death domain death domain-containing protein CRADD|CRADD/LYZ fusion|RIP-associated ICH1/CED3-homologous protein with death domain|caspase and RIP adaptor with death domain|death adaptor molecule RAIDD|death domain containing protein CRADD

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CRADD, check out the CRADD Infographic

CRADD infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRADD: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP78560

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RAIDD (CRADD) (NM_003805) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RAIDD (CRADD) (NM_003805) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RAIDD (CRADD) (NM_003805) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP78560
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.