RAC1 (NM_018890) Human Recombinant Protein

Rac1 protein,

Product Info Summary

SKU: PROTP63000
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RAC1 (NM_018890) Human Recombinant Protein

View all Rac1 recombinant proteins

SKU/Catalog Number

PROTP63000

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), transcript variant Rac1b

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RAC1 (NM_018890) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP63000)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.3 kDa

Amino Acid Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For RAC1 (Source: Uniprot.org, NCBI)

Gene Name

RAC1

Full Name

Ras-related C3 botulinum toxin substrate 1

Weight

23.3 kDa

Superfamily

small GTPase superfamily

Alternative Names

Cell migration-inducing gene 5 protein; MGC111543; p21-Rac1; p21-Rac1migration-inducing gene 5; Rac1; Ras-like protein TC25; ras-related C3 botulinum toxin substrate 1 (rho family, small GTP bindingprotein Rac1); ras-related C3 botulinum toxin substrate 1; rho family, small GTP binding protein Rac1; TC25; TC-25 RAC1 MIG5, MRD48, Rac-1, TC-25, p21-Rac1 Rac family small GTPase 1 ras-related C3 botulinum toxin substrate 1|cell migration-inducing gene 5 protein|ras-like protein TC25|ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RAC1, check out the RAC1 Infographic

RAC1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RAC1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP63000

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RAC1 (NM_018890) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RAC1 (NM_018890) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RAC1 (NM_018890) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP63000
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product