Click image to see more details
Product Info Summary
| SKU: | A00303-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | Flow Cytometry, IHC, IHC-F, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-VASP Antibody Picoband®
SKU/Catalog Number
A00303-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-VASP Antibody Picoband® catalog # A00303-1. Tested in Flow Cytometry, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-VASP Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00303-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human VASP, different from the related mouse sequence by four amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A00303-1 is reactive to VASP in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
40 kDa
Calculated molecular weight
39830 MW
Background of VASP
Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins. Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin. VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility. VASP may also be involved in the intracellular signaling pathways that regulate integrin-extracellular matrix interactions. VASP is regulated by the cyclic nucleotide-dependent kinases PKA and PKG.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00303-1 is guaranteed for Flow Cytometry, IHC, IHC-F, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry, 0.5-1μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: rat liver tissue, mouse kidney tissue, HELA whole cell, HEPG2 whole cell
IHC: human lung cancer tissue, human mammary cancer tissue
FCM: SiHa cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of VASP using anti-VASP antibody (A00303-1). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysates, Lane 2: mouse kidney tissue lysates, Lane 3: HELA whole cell lysates, Lane 4: HEPG2 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-VASP antigen affinity purified polyclonal antibody (Catalog # A00303-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for VASP at approximately 40KD. The expected band size for VASP is at 40KD.
Click image to see more details
Figure 2. IHC analysis of VASP using anti-VASP antibody (A00303-1). VASP was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-VASP Antibody (A00303-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of VASP using anti-VASP antibody (A00303-1). VASP was detected in paraffin-embedded section of human mammary cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-VASP Antibody (A00303-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. Flow Cytometry analysis of SiHa cells using anti-VASP antibody (A00303-1).
Overlay histogram showing SiHa cells stained with A00303-1 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-VASP Antibody (A00303-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For VASP (Source: Uniprot.org, NCBI)
Gene Name
VASP
Full Name
Vasodilator-stimulated phosphoprotein
Weight
39830 MW
Superfamily
Ena/VASP family
Alternative Names
Vasodilator-stimulated phosphoprotein;VASP;VASP; VASP vasodilator stimulated phosphoprotein vasodilator-stimulated phosphoprotein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on VASP, check out the VASP Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for VASP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-VASP Antibody Picoband® (A00303-1)
Hello CJ!
No publications found for A00303-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-VASP Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-VASP Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-VASP Antibody Picoband®
Question
I see that the anti-VASP antibody A00303-1 works with IHC-P, what is the protocol used to produce the result images on the product page?
H. Anderson
Verified customer
Asked: 2020-03-26
Answer
You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-03-26
Question
We are currently using anti-VASP antibody A00303-1 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on goat tissues as well?
E. Carter
Verified customer
Asked: 2019-12-02
Answer
The anti-VASP antibody (A00303-1) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-12-02
Question
Is this A00303-1 anti-VASP antibody reactive to the isotypes of VASP?
Verified Customer
Verified customer
Asked: 2019-12-02
Answer
The immunogen of A00303-1 anti-VASP antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human VASP (78-114aa NFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALE), different from the related mouse sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-12-02
Question
My boss were content with the WB result of your anti-VASP antibody. However we have seen positive staining in fetal spleen skin cytoplasm. cytoplasm using this antibody. Is that expected? Could you tell me where is VASP supposed to be expressed?
R. Krishna
Verified customer
Asked: 2019-07-11
Answer
Based on literature, fetal spleen skin does express VASP. Generally VASP expresses in cytoplasm. cytoplasm, cytoskeleton. cell. Regarding which tissues have VASP expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Fetal lung, Fetal spleen, and Skin, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Platelet, Pubmed ID: 12665801, 18088087
Promyelocyte, Pubmed ID: 7828592
Substantia nigra, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-07-11
Question
Do you have a BSA free version of anti-VASP antibody A00303-1 available?
J. Moore
Verified customer
Asked: 2019-06-13
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-VASP antibody A00303-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-06-13
Question
I was wanting to use your anti-VASP antibody for IHC-P for mouse platelet on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse platelet identification?
Verified Customer
Verified customer
Asked: 2019-02-20
Answer
As indicated on the product datasheet, A00303-1 anti-VASP antibody has been validated for Flow Cytometry, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse platelet in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-02-20
Question
We need using your anti-VASP antibody for protein homotetramerization studies. Has this antibody been tested with western blotting on u937 cells? We would like to see some validation images before ordering.
B. Walker
Verified customer
Asked: 2018-12-25
Answer
Thanks for your inquiry. This A00303-1 anti-VASP antibody is tested on rat liver tissue, mouse kidney tissue, hela whole cell lysates, hepg2 whole cell lysates, siha cells, u937 cells. It is guaranteed to work for Flow Cytometry, IHC-P, IHC-F, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2018-12-25
Question
Is a blocking peptide available for product anti-VASP antibody (A00303-1)?
J. Parker
Verified customer
Asked: 2018-12-03
Answer
We do provide the blocking peptide for product anti-VASP antibody (A00303-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-12-03
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for platelet using anti-VASP antibody A00303-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2018-10-17
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-10-17
Question
Can you help my question with product A00303-1, anti-VASP antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2018-10-10
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00303-1 anti-VASP antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-10-10
Question
We ordered your anti-VASP antibody for ICC on liver in a previous project. I am using mouse, and I plan to use the antibody for WB next. We want examining liver as well as leukemic t-cell in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?
M. Zhao
Verified customer
Asked: 2018-05-28
Answer
I looked at the website and datasheets of our anti-VASP antibody and I see that A00303-1 has been validated on mouse in both ICC and WB. Thus A00303-1 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2018-05-28
Question
I am interested in to test anti-VASP antibody A00303-1 on mouse platelet for research purposes, then I may be interested in using anti-VASP antibody A00303-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-01-02
Answer
The products we sell, including anti-VASP antibody A00303-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-01-02
Question
Here is the WB image, lot number and protocol we used for platelet using anti-VASP antibody A00303-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2017-12-08
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-12-08
Question
We have seen staining in mouse blood. Any tips? Is anti-VASP antibody supposed to stain blood positively?
Verified Customer
Verified customer
Asked: 2017-09-05
Answer
From what I have seen in literature blood does express VASP. From what I have seen in Uniprot.org, VASP is expressed in blood, promyelocyte, substantia nigra, fetal lung, fetal spleen skin, platelet, cervix carcinoma, leukemic t-cell, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have VASP expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Fetal lung, Fetal spleen, and Skin, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Platelet, Pubmed ID: 12665801, 18088087
Promyelocyte, Pubmed ID: 7828592
Substantia nigra, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2017-09-05
Question
Will anti-VASP antibody A00303-1 work for IHC-P with platelet?
E. Wu
Verified customer
Asked: 2017-06-15
Answer
According to the expression profile of platelet, VASP is highly expressed in platelet. So, it is likely that anti-VASP antibody A00303-1 will work for IHC-P with platelet.
Boster Scientific Support
Answered: 2017-06-15
Question
Does A00303-1 anti-VASP antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
A. Miller
Verified customer
Asked: 2014-05-22
Answer
It shows on the product datasheet, A00303-1 anti-VASP antibody as been tested on IHC-P. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2014-05-22
