RABL2A (NM_007082) Human Recombinant Protein

RABL2A protein,

Recombinant protein of human RAB, member of RAS oncogene family-like 2A (RABL2A), transcript variant 2

Product Info Summary

SKU: PROTQ9UBK7
Size: 20 µg
Source: HEK293T

Product Name

RABL2A (NM_007082) Human Recombinant Protein

View all RABL2A recombinant proteins

SKU/Catalog Number

PROTQ9UBK7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAB, member of RAS oncogene family-like 2A (RABL2A), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RABL2A (NM_007082) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UBK7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.9 kDa

Amino Acid Sequence

MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS

Validation Images & Assay Conditions

Gene/Protein Information For RABL2A (Source: Uniprot.org, NCBI)

Gene Name

RABL2A

Full Name

Rab-like protein 2A

Weight

25.9 kDa

Superfamily

small GTPase superfamily

Alternative Names

FLJ78724; MGC117180; RAB, member of RAS oncogene family-like 2A; rab-like protein 2A RABL2A RAB, member of RAS oncogene family like 2A rab-like protein 2A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RABL2A, check out the RABL2A Infographic

RABL2A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RABL2A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UBK7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RABL2A (NM_007082) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RABL2A (NM_007082) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RABL2A (NM_007082) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UBK7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.