PHPT1 (NM_014172) Human Recombinant Protein

PHPT1 protein,

Product Info Summary

SKU: PROTQ9NRX4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PHPT1 (NM_014172) Human Recombinant Protein

View all PHPT1 recombinant proteins

SKU/Catalog Number

PROTQ9NRX4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PHPT1 (NM_014172) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NRX4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.7 kDa

Amino Acid Sequence

MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

Validation Images & Assay Conditions

Gene/Protein Information For PHPT1 (Source: Uniprot.org, NCBI)

Gene Name

PHPT1

Full Name

14 kDa phosphohistidine phosphatase

Weight

13.7 kDa

Superfamily

janus family

Alternative Names

bA216L13.10; DKFZp564M173; EC 3.1.3,14 kDa phosphohistidine phosphatase; EC 3.1.3.-; HSPC141; phosphohistidine phosphatase 11700008C22Rik; phosphohistidine phosphatase 14kDa; PHP14CGI-202; Protein janus-A homolog; RP11-216L13.10; sex-regulated protein janus-a PHPT1 CGI-202, HEL-S-132P, HSPC141, PHP, PHP14 phosphohistidine phosphatase 1 14 kDa phosphohistidine phosphatase|epididymis secretory sperm binding protein Li 132P|protein histidine phosphatase|protein janus-A homolog|sex-regulated protein janus-a

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PHPT1, check out the PHPT1 Infographic

PHPT1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PHPT1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NRX4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PHPT1 (NM_014172) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PHPT1 (NM_014172) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PHPT1 (NM_014172) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NRX4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.