RAB31 (NM_006868) Human Recombinant Protein

RAB31 protein,

Product Info Summary

SKU: PROTQ13636
Size: 20 µg
Source: HEK293T

Product Name

RAB31 (NM_006868) Human Recombinant Protein

View all RAB31 recombinant proteins

SKU/Catalog Number

PROTQ13636

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAB31, member RAS oncogene family (RAB31)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RAB31 (NM_006868) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13636)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.5 kDa

Amino Acid Sequence

MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC

Validation Images & Assay Conditions

Gene/Protein Information For RAB31 (Source: Uniprot.org, NCBI)

Gene Name

RAB31

Full Name

Ras-related protein Rab-31

Weight

21.5 kDa

Superfamily

small GTPase superfamily

Alternative Names

Rab22B; RAB31, member RAS oncogene family; Ras-related protein Rab-22B; ras-related protein Rab-31 RAB31 Rab22B RAB31, member RAS oncogene family ras-related protein Rab-31|ras-related protein Rab-22B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RAB31, check out the RAB31 Infographic

RAB31 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RAB31: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13636

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RAB31 (NM_006868) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RAB31 (NM_006868) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RAB31 (NM_006868) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13636
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product