RAB27A (NM_183234) Human Recombinant Protein

RAB27A protein,

Product Info Summary

SKU: PROTP51159
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RAB27A (NM_183234) Human Recombinant Protein

View all RAB27A recombinant proteins

SKU/Catalog Number

PROTP51159

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAB27A, member RAS oncogene family (RAB27A), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RAB27A (NM_183234) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP51159)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.7 kDa

Amino Acid Sequence

MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC

Validation Images & Assay Conditions

Gene/Protein Information For RAB27A (Source: Uniprot.org, NCBI)

Gene Name

RAB27A

Full Name

Ras-related protein Rab-27A

Weight

24.7 kDa

Superfamily

small GTPase superfamily

Alternative Names

GS2; GS2rab-27; GTP-binding protein Ram; HsT18676; Rab-27; Rab27a; RAB27A, member RAS oncogene family; RAB27MGC117246; RAM; RAMras-related protein Rab-27A RAB27A GS2, HsT18676, RAB27, RAM RAB27A, member RAS oncogene family ras-related protein Rab-27A|GTP-binding protein Ram|mutant Ras-related protein Rab-27A|rab-27

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RAB27A, check out the RAB27A Infographic

RAB27A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RAB27A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP51159

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RAB27A (NM_183234) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RAB27A (NM_183234) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RAB27A (NM_183234) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP51159
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.