PSMD8 (NM_002812) Human Recombinant Protein

PSMD8 protein,

Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8)

Product Info Summary

SKU: PROTP48556
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PSMD8 (NM_002812) Human Recombinant Protein

View all PSMD8 recombinant proteins

SKU/Catalog Number

PROTP48556

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PSMD8 (NM_002812) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP48556)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39.4 kDa

Amino Acid Sequence

MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

Validation Images & Assay Conditions

Gene/Protein Information For PSMD8 (Source: Uniprot.org, NCBI)

Gene Name

PSMD8

Full Name

26S proteasome non-ATPase regulatory subunit 8

Weight

39.4 kDa

Superfamily

proteasome subunit S14 family

Alternative Names

26S proteasome non-ATPase regulatory subunit 8; 26S proteasome regulatory subunit p31; HIP6,26S proteasome regulatory subunit S14; HYPF; MGC1660; Nin1p; p3126S proteasome regulatory subunit RPN12; proteasome (prosome, macropain) 26S subunit, non-ATPase, 8; Rpn12; S14 PSMD8 HEL-S-91n, HIP6, HYPF, Nin1p, Rpn12, S14, p31 proteasome 26S subunit, non-ATPase 8 26S proteasome non-ATPase regulatory subunit 8|26S proteasome regulatory subunit RPN12|26S proteasome regulatory subunit S14|26S proteasome regulatory subunit p31|epididymis secretory sperm binding protein Li 91n|proteasome (prosome, macropain) 26S subunit, non-ATPase, 8

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PSMD8, check out the PSMD8 Infographic

PSMD8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PSMD8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP48556

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PSMD8 (NM_002812) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PSMD8 (NM_002812) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PSMD8 (NM_002812) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP48556
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.