PSF3 (GINS3) (NM_022770) Human Recombinant Protein

PSF3 protein,

Recombinant protein of human GINS complex subunit 3 (Psf3 homolog) (GINS3), transcript variant 2

Product Info Summary

SKU: PROTQ9BRX5
Size: 20 µg
Source: HEK293T

Product Name

PSF3 (GINS3) (NM_022770) Human Recombinant Protein

View all PSF3 recombinant proteins

SKU/Catalog Number

PROTQ9BRX5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human GINS complex subunit 3 (Psf3 homolog) (GINS3), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PSF3 (GINS3) (NM_022770) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BRX5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.4 kDa

Amino Acid Sequence

MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED

Validation Images & Assay Conditions

Gene/Protein Information For GINS3 (Source: Uniprot.org, NCBI)

Gene Name

GINS3

Full Name

DNA replication complex GINS protein PSF3

Weight

24.4 kDa

Superfamily

GINS3/PSF3 family

Alternative Names

DNA replication complex GINS protein PSF3; GINS complex subunit 3 (Psf3 homolog); GINS complex subunit 3; PSF3FLJ13912 GINS3 PSF3 GINS complex subunit 3 DNA replication complex GINS protein PSF3|GINS complex subunit 3 (Psf3 homolog)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GINS3, check out the GINS3 Infographic

GINS3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GINS3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BRX5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PSF3 (GINS3) (NM_022770) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PSF3 (GINS3) (NM_022770) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PSF3 (GINS3) (NM_022770) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BRX5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.