PRICKLE4 (NM_013397) Human Recombinant Protein

PRICKLE4 protein,

Recombinant protein of human prickle homolog 4 (Drosophila) (PRICKLE4)

Product Info Summary

SKU: PROTQ2TBC4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PRICKLE4 (NM_013397) Human Recombinant Protein

View all PRICKLE4 recombinant proteins

SKU/Catalog Number

PROTQ2TBC4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human prickle homolog 4 (Drosophila) (PRICKLE4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PRICKLE4 (NM_013397) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ2TBC4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41.6 kDa

Amino Acid Sequence

MSVQNSGWPHQEDSPKPQDPGPPANSDSDSGHLPGEDPEDTHAQGPAVLSLGSLCLDTNQAPNWTGLQTLLQQLPPQDIDERYCLALGEEERAELQLFCARRKQEALGQGVARLVLPKLEGHTCEKCRELLKPGEYGVFAARAGEQRCWHQPCFACQACGQALINLIYFYHDGQLYCGRHHAELLRPRCPACDQLIFSWRCTEAEGQRWHENHFCCQDCAGPLGGGRYALPGGSPCCPSCFENRYSDAGSSWAGALEGQAFLGETGLDRTEGRDQTSVNSATLSRTLLAAAGGSSLQTQRGLPGSSPQQENRPGDKAEAPKGQEQCRLETIRDPKDTPFSTCSSSSDSEPEGFFLGERLPQSWKTPGSLQAEDSNASKTHCTMC

Validation Images & Assay Conditions

Gene/Protein Information For PRICKLE4 (Source: Uniprot.org, NCBI)

Gene Name

PRICKLE4

Full Name

Prickle-like protein 4

Weight

41.6 kDa

Superfamily

prickle / espinas / testin family

Alternative Names

over-expressed breast tumor protein; prickle homolog 4 (Drosophila); prickle-like protein 4 PRICKLE4 C6orf49, OBTP, OEBT, TOMM6 prickle planar cell polarity protein 4 prickle-like protein 4|over-expressed breast tumor protein|overexpressed breast tumor protein|overexpressed breast tumour protein|prickle homolog 4|translocase of outer mitochondrial membrane 6 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRICKLE4, check out the PRICKLE4 Infographic

PRICKLE4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRICKLE4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ2TBC4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PRICKLE4 (NM_013397) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PRICKLE4 (NM_013397) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PRICKLE4 (NM_013397) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ2TBC4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.