PPP1R16A (NM_032902) Human Recombinant Protein

Ppp1r16a protein,

Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 16A (PPP1R16A)

Product Info Summary

SKU: PROTQ96I34
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PPP1R16A (NM_032902) Human Recombinant Protein

View all Ppp1r16a recombinant proteins

SKU/Catalog Number

PROTQ96I34

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 16A (PPP1R16A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PPP1R16A (NM_032902) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96I34)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

57.6 kDa

Amino Acid Sequence

MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVRRVSLTQRTDLYRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPPEEDNPEVVRPHNGRVGGSPVRHLYSKRLDRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDTVTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM

Validation Images & Assay Conditions

Gene/Protein Information For Ppp1r16a (Source: Uniprot.org, NCBI)

Gene Name

Ppp1r16a

Full Name

Protein phosphatase 1 regulatory subunit 16A

Weight

57.6 kDa

Alternative Names

likley ortholog of mouse myosin phosphatase targeting subunit 3; Myosin phosphatase-targeting subunit 3; MYPT3MGC14333; protein phosphatase 1 regulatory subunit 16A; protein phosphatase 1, regulatory (inhibitor) subunit 16A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Ppp1r16a, check out the Ppp1r16a Infographic

Ppp1r16a infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Ppp1r16a: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96I34

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PPP1R16A (NM_032902) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PPP1R16A (NM_032902) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PPP1R16A (NM_032902) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96I34
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.