POLR2L (NM_021128) Human Recombinant Protein

POLR2L protein,

Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L)

Product Info Summary

SKU: PROTP62875
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

POLR2L (NM_021128) Human Recombinant Protein

View all POLR2L recombinant proteins

SKU/Catalog Number

PROTP62875

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

POLR2L (NM_021128) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP62875)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

7.5 kDa

Amino Acid Sequence

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

Validation Images & Assay Conditions

Gene/Protein Information For POLR2L (Source: Uniprot.org, NCBI)

Gene Name

POLR2L

Full Name

DNA-directed RNA polymerases I, II, and III subunit RPABC5

Weight

7.5 kDa

Superfamily

archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family

Alternative Names

DNA-directed RNA polymerase III subunit L; DNA-directed RNA polymerases I, II, and III subunit RPABC5; EC 2.7.7.6; hRPB7.6; hsRPB10b; polymerase (RNA) II (DNA directed) polypeptide L (7.6kD); polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa; RBP10; RNA polymerase II 7.6 kDa subunit; RPABC5; RPB10 homolog; RPB10; RPB10beta; RPB7.6RNA polymerases I, II, and III subunit ABC5 POLR2L RBP10, RPABC5, RPB10, RPB10beta, RPB7.6, hRPB7.6 RNA polymerase II, I and III subunit L DNA-directed RNA polymerases I, II, and III subunit RPABC5|DNA-directed RNA polymerase III subunit L|RNA polymerase II 7.6 kDa subunit|RNA polymerase II subunit L|RNA polymerases I, II, and III subunit ABC5|RPB10 homolog|polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa|polymerase (RNA) II subunit L

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POLR2L, check out the POLR2L Infographic

POLR2L infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POLR2L: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP62875

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used POLR2L (NM_021128) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For POLR2L (NM_021128) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for POLR2L (NM_021128) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP62875
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.