POLR2F (NM_021974) Human Recombinant Protein

POLR2F protein,

Product Info Summary

SKU: PROTP61218
Size: 20 µg
Source: HEK293T

Product Name

POLR2F (NM_021974) Human Recombinant Protein

View all POLR2F recombinant proteins

SKU/Catalog Number

PROTP61218

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide F (POLR2F)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

POLR2F (NM_021974) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP61218)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.3 kDa

Amino Acid Sequence

MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD

Validation Images & Assay Conditions

Gene/Protein Information For POLR2F (Source: Uniprot.org, NCBI)

Gene Name

POLR2F

Full Name

DNA-directed RNA polymerases I, II, and III subunit RPABC2

Weight

14.3 kDa

Superfamily

archaeal RpoK/eukaryotic RPB6 RNA polymerase subunit family

Alternative Names

DNA-directed RNA polymerase II subunit F; DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide; HRBP14.4; II, and III subunit RPABC2; polymerase (RNA) II (DNA directed) polypeptide F; RNA Polymerase II subunit 14.4 kD; RNA polymerases I, II, and III subunit ABC2; RPB6 homolog; RPB6 POLR2F HRBP14.4, POLRF, RPABC14.4, RPABC2, RPB14.4, RPB6, RPC15 RNA polymerase II, I and III subunit F DNA-directed RNA polymerases I, II, and III subunit RPABC2|DNA-directed RNA polymerase II subunit F|DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide|RNA Polymerase II subunit 14.4 kD|RNA polymerase II subunit F|RNA polymerases I, II, and III subunit ABC2|polymerase (RNA) II (DNA directed) polypeptide F|polymerase (RNA) II subunit F

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POLR2F, check out the POLR2F Infographic

POLR2F infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POLR2F: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP61218

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used POLR2F (NM_021974) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For POLR2F (NM_021974) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for POLR2F (NM_021974) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP61218
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.