POLR1C (NM_203290) Human Recombinant Protein

POLR1C protein,

Product Info Summary

SKU: PROTO15160
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

POLR1C (NM_203290) Human Recombinant Protein

View all POLR1C recombinant proteins

SKU/Catalog Number

PROTO15160

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

POLR1C (NM_203290) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15160)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39.1 kDa

Amino Acid Sequence

MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD

Validation Images & Assay Conditions

Gene/Protein Information For POLR1C (Source: Uniprot.org, NCBI)

Gene Name

POLR1C

Full Name

DNA-directed RNA polymerases I and III subunit RPAC1

Weight

39.1 kDa

Superfamily

archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family

Alternative Names

AC40; DNA-directed RNA polymerase I subunit C; DNA-directed RNA polymerases I and III 40 kDa polypeptide; POLR1E; polymerase (RNA) I polypeptide C, 30kDa; RNA polymerase I subunit; RPA39RNA polymerases I and III subunit AC1; RPA40TCS3; RPA5RPAC1DNA-directed RNA polymerases I and III subunit RPAC1; RPC40 POLR1C AC40, HLD11, RPA39, RPA40, RPA5, RPAC1, RPC40, TCS3 RNA polymerase I and III subunit C DNA-directed RNA polymerases I and III subunit RPAC1|DNA-directed RNA polymerase I subunit C|DNA-directed RNA polymerases I and III 40 kDa polypeptide|RNA polymerase I subunit C|RNA polymerases I and III subunit AC1|polymerase (RNA) I polypeptide C, 30kDa|polymerase (RNA) I subunit C

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POLR1C, check out the POLR1C Infographic

POLR1C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POLR1C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15160

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used POLR1C (NM_203290) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For POLR1C (NM_203290) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for POLR1C (NM_203290) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15160
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.