PLCXD1 (NM_018390) Human Recombinant Protein

PLCXD1 protein,

Recombinant protein of human phosphatidylinositol-specific phospholipase C, X domain containing 1 (PLCXD1)

Product Info Summary

SKU: PROTQ9NUJ7
Size: 20 µg
Source: HEK293T

Product Name

PLCXD1 (NM_018390) Human Recombinant Protein

View all PLCXD1 recombinant proteins

SKU/Catalog Number

PROTQ9NUJ7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphatidylinositol-specific phospholipase C, X domain containing 1 (PLCXD1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PLCXD1 (NM_018390) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NUJ7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.5 kDa

Amino Acid Sequence

MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEWLERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRRHHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRLSAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC

Validation Images & Assay Conditions

Gene/Protein Information For PLCXD1 (Source: Uniprot.org, NCBI)

Gene Name

PLCXD1

Full Name

PI-PLC X domain-containing protein 1

Weight

36.5 kDa

Alternative Names

FLJ11323; phosphatidylinositol-specific phospholipase C, X domain containing 1; PI-PLC X domain-containing protein 1 PLCXD1 LL0XNC01-136G2.1 phosphatidylinositol specific phospholipase C X domain containing 1 PI-PLC X domain-containing protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PLCXD1, check out the PLCXD1 Infographic

PLCXD1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PLCXD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NUJ7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PLCXD1 (NM_018390) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PLCXD1 (NM_018390) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PLCXD1 (NM_018390) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NUJ7
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.