MCEMP1 (NM_174918) Human Recombinant Protein

Mcemp1 protein,

Recombinant protein of human chromosome 19 open reading frame 59 (C19orf59)

Product Info Summary

SKU: PROTQ8IX19
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MCEMP1 (NM_174918) Human Recombinant Protein

View all Mcemp1 recombinant proteins

SKU/Catalog Number

PROTQ8IX19

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 19 open reading frame 59 (C19orf59)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MCEMP1 (NM_174918) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8IX19)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21 kDa

Amino Acid Sequence

MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTSQVPAQCRPPSDSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKRELWNVSNSVQACEERQKRGWDSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ

Validation Images & Assay Conditions

Gene/Protein Information For MCEMP1 (Source: Uniprot.org, NCBI)

Gene Name

MCEMP1

Full Name

Mast cell-expressed membrane protein 1

Weight

21 kDa

Alternative Names

C19orf59; chromosome 19 open reading frame 59; mast cell-expressed membrane protein 1; MCEMP1; MGC132456

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MCEMP1, check out the MCEMP1 Infographic

MCEMP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MCEMP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8IX19

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MCEMP1 (NM_174918) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MCEMP1 (NM_174918) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MCEMP1 (NM_174918) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8IX19
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.