Placental lactogen (CSH2) (NM_022645) Human Recombinant Protein

CSH2 protein,

Recombinant protein of human chorionic somatomammotropin hormone 2 (CSH2), transcript variant 3

Product Info Summary

SKU: PROTP0DML3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Placental lactogen (CSH2) (NM_022645) Human Recombinant Protein

View all CSH2 recombinant proteins

SKU/Catalog Number

PROTP0DML3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chorionic somatomammotropin hormone 2 (CSH2), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Placental lactogen (CSH2) (NM_022645) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP0DML3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.7 kDa

Amino Acid Sequence

MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Validation Images & Assay Conditions

Gene/Protein Information For CSH2 (Source: Uniprot.org, NCBI)

Gene Name

CSH2

Full Name

Chorionic somatomammotropin hormone 2

Weight

13.7 kDa

Superfamily

somatotropin/prolactin family

Alternative Names

chorionic somatomammotropin B; chorionic somatomammotropin hormone 2; CS-2; CSBChoriomammotropin; hCS-B; Lactogen; PL; Placental lactogen CSH2 CS-2, CSB, GHB1, PL, hCS-B chorionic somatomammotropin hormone 2 chorionic somatomammotropin hormone 2|choriomammotropin|chorionic somatomammotropin B|growth hormone B1|lactogen|placental lactogen

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CSH2, check out the CSH2 Infographic

CSH2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSH2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP0DML3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Placental lactogen (CSH2) (NM_022645) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Placental lactogen (CSH2) (NM_022645) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Placental lactogen (CSH2) (NM_022645) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP0DML3
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.