PLA2G12B (NM_032562) Human Recombinant Protein

Pla2g12b protein,

Recombinant protein of human phospholipase A2, group XIIB (PLA2G12B)

Product Info Summary

SKU: PROTQ9BX93
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PLA2G12B (NM_032562) Human Recombinant Protein

View all Pla2g12b recombinant proteins

SKU/Catalog Number

PROTQ9BX93

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phospholipase A2, group XIIB (PLA2G12B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PLA2G12B (NM_032562) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BX93)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.5 kDa

Amino Acid Sequence

MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL

Validation Images & Assay Conditions

Gene/Protein Information For PLA2G12B (Source: Uniprot.org, NCBI)

Gene Name

PLA2G12B

Full Name

Group XIIB secretory phospholipase A2-like protein

Weight

21.5 kDa

Superfamily

phospholipase A2 family

Alternative Names

group XIIB secretory phospholipase A2-like protein; group XIII secreted phospholipase A2; Group XIII secretory phospholipase A2-like protein; GXIIBMGC138151; GXIII sPLA2-like; GXIIIsPLA2; phospholipase A2, group XIIB; phospholipase A2, group XIII; PLA2G13; sPLA2-GXIIB

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PLA2G12B, check out the PLA2G12B Infographic

PLA2G12B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PLA2G12B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BX93

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PLA2G12B (NM_032562) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PLA2G12B (NM_032562) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PLA2G12B (NM_032562) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BX93
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product