PITPNB (NM_012399) Human Recombinant Protein

PITPNB protein,

Product Info Summary

SKU: PROTP48739
Size: 20 µg
Source: HEK293T

Product Name

PITPNB (NM_012399) Human Recombinant Protein

View all PITPNB recombinant proteins

SKU/Catalog Number

PROTP48739

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphatidylinositol transfer protein, beta (PITPNB)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PITPNB (NM_012399) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP48739)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.4 kDa

Amino Acid Sequence

MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV

Validation Images & Assay Conditions

Gene/Protein Information For PITPNB (Source: Uniprot.org, NCBI)

Gene Name

PITPNB

Full Name

Phosphatidylinositol transfer protein beta isoform

Weight

31.4 kDa

Superfamily

PtdIns transfer protein family

Alternative Names

phosphatidylinositol transfer protein beta isoform; phosphatidylinositol transfer protein, beta; phosphotidylinositol transfer protein, beta; PI-TP-beta; PtdIns transfer protein beta; PtdInsTP beta; PtdInsTP; VIB1B PITPNB PI-TP-beta, PtdInsTP, VIB1B phosphatidylinositol transfer protein beta phosphatidylinositol transfer protein beta isoform|PtdIns transfer protein beta|phosphotidylinositol transfer protein, beta

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PITPNB, check out the PITPNB Infographic

PITPNB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PITPNB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP48739

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PITPNB (NM_012399) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PITPNB (NM_012399) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PITPNB (NM_012399) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP48739
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.