PERP (NM_022121) Human Recombinant Protein

Perp protein,

Recombinant protein of human PERP, TP53 apoptosis effector (PERP)

Product Info Summary

SKU: PROTQ96FX8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PERP (NM_022121) Human Recombinant Protein

View all Perp recombinant proteins

SKU/Catalog Number

PROTQ96FX8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human PERP, TP53 apoptosis effector (PERP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PERP (NM_022121) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96FX8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.2 kDa

Amino Acid Sequence

MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

Validation Images & Assay Conditions

Gene/Protein Information For Perp (Source: Uniprot.org, NCBI)

Gene Name

Perp

Full Name

p53 apoptosis effector related to PMP-22

Weight

21.2 kDa

Superfamily

TMEM47 family

Alternative Names

dJ496H19.1; KCP1KCP-1; Keratinocyte-associated protein 1; KRTCAP11110017A08Rik; p53 apoptosis effector related to PMP22; p53 apoptosis effector related to PMP-22; P53-induced protein PIGPC1; PERP, TP53 apoptosis effector; PIGPC1RP3-496H19.1; THWkeratinocytes associated protein 1; Transmembrane protein THW Perp|1110017A08Rik, KCP, KCP1, KRTC, KRTCAP1, PIG, PIGPC1, THW|PERP, TP53 apoptosis effector|p53 apoptosis effector related to PMP-22|KCP-1|keratinocyte-associated protein 1|p53 apoptosis effector related to Pmp22|p53 apoptosis-associated target

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Perp, check out the Perp Infographic

Perp infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Perp: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96FX8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PERP (NM_022121) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PERP (NM_022121) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PERP (NM_022121) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96FX8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.