Peroxiredoxin 4 (PRDX4) (NM_006406) Human Recombinant Protein

Peroxiredoxin 4 protein,

Product Info Summary

SKU: PROTQ13162
Size: 20 µg
Source: HEK293T

Product Name

Peroxiredoxin 4 (PRDX4) (NM_006406) Human Recombinant Protein

View all Peroxiredoxin 4 recombinant proteins

SKU/Catalog Number

PROTQ13162

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human peroxiredoxin 4 (PRDX4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Peroxiredoxin 4 (PRDX4) (NM_006406) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13162)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.4 kDa

Amino Acid Sequence

MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

Validation Images & Assay Conditions

Gene/Protein Information For PRDX4 (Source: Uniprot.org, NCBI)

Gene Name

PRDX4

Full Name

Peroxiredoxin-4

Weight

30.4 kDa

Superfamily

peroxiredoxin family

Alternative Names

Antioxidant enzyme AOE372; AOE372; AOE37-2PRX-4; EC 1.11.1.15; Peroxiredoxin 4; Peroxiredoxin IV; peroxiredoxin-4; PRDX4; Prx4; prx-4; prx-IV; thioredoxin peroxidase (antioxidant enzyme); Thioredoxin peroxidase AO372; Thioredoxin-dependent peroxide reductase A0372 PRDX4 AOE37-2, AOE372, HEL-S-97n, PRX-4 peroxiredoxin 4 peroxiredoxin-4|antioxidant enzyme AOE372|epididymis secretory sperm binding protein Li 97n|peroxiredoxin IV|prx-IV|thioredoxin peroxidase (antioxidant enzyme)|thioredoxin peroxidase AO372|thioredoxin-dependent peroxide reductase A0372|thioredoxin-dependent peroxiredoxin 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRDX4, check out the PRDX4 Infographic

PRDX4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRDX4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13162

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Peroxiredoxin 4 (PRDX4) (NM_006406) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Peroxiredoxin 4 (PRDX4) (NM_006406) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Peroxiredoxin 4 (PRDX4) (NM_006406) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13162
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.