Peroxiredoxin 1 (PRDX1) (NM_002574) Human Recombinant Protein

Peroxiredoxin 1 protein,

Product Info Summary

SKU: PROTQ06830
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Peroxiredoxin 1 (PRDX1) (NM_002574) Human Recombinant Protein

View all Peroxiredoxin 1 recombinant proteins

SKU/Catalog Number

PROTQ06830

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Peroxiredoxin 1 (PRDX1) (NM_002574) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ06830)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.9 kDa

Amino Acid Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Validation Images & Assay Conditions

Gene/Protein Information For PRDX1 (Source: Uniprot.org, NCBI)

Gene Name

PRDX1

Full Name

Peroxiredoxin-1

Weight

21.9 kDa

Superfamily

peroxiredoxin family

Alternative Names

EC 1.11.1; EC 1.11.1.15; Natural killer cell-enhancing factor A; natural killer-enhancing factor A; NKEFA; NKEF-A; PAG; PAGAMSP23; PAGB; Peroxiredoxin 1; peroxiredoxin-1; PRDX1; proliferation-associated gene A; Proliferation-associated gene protein; PRX1; PRXI; TDPX2; Thioredoxin peroxidase 2; Thioredoxin-dependent peroxide reductase 2 PRDX1 MSP23, NKEF-A, NKEFA, PAG, PAGA, PAGB, PRX1, PRXI, TDPX2 peroxiredoxin 1 peroxiredoxin-1|epididymis secretory sperm binding protein|natural killer cell-enhancing factor A|natural killer-enhancing factor A|proliferation-associated gene A|proliferation-associated gene protein|thioredoxin peroxidase 2|thioredoxin-dependent peroxide reductase 2|thioredoxin-dependent peroxiredoxin 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRDX1, check out the PRDX1 Infographic

PRDX1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRDX1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ06830

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Peroxiredoxin 1 (PRDX1) (NM_002574) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Peroxiredoxin 1 (PRDX1) (NM_002574) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Peroxiredoxin 1 (PRDX1) (NM_002574) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ06830
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.