PEA15 (NM_003768) Human Recombinant Protein

PEA-15 protein,

Product Info Summary

SKU: PROTQ15121
Size: 20 µg
Source: HEK293T

Product Name

PEA15 (NM_003768) Human Recombinant Protein

View all PEA-15 recombinant proteins

SKU/Catalog Number

PROTQ15121

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphoprotein enriched in astrocytes 15 (PEA15)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PEA15 (NM_003768) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15121)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.9 kDa

Amino Acid Sequence

MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

Validation Images & Assay Conditions

Gene/Protein Information For PEA15 (Source: Uniprot.org, NCBI)

Gene Name

PEA15

Full Name

Astrocytic phosphoprotein PEA-15

Weight

14.9 kDa

Alternative Names

HMAT1; HMAT115kD; HUMMAT1H; MAT1H; PEA15; PEA-15; PED; PED15 kDa phosphoprotein enriched in astrocytes; phosphoprotein enriched in astrocytes 15; Phosphoprotein enriched in diabetes PEA15 HMAT1, HUMMAT1H, MAT1, MAT1H, PEA-15, PED, PED-PEA15, PED/PEA15 proliferation and apoptosis adaptor protein 15 astrocytic phosphoprotein PEA-15|15 kDa phosphoprotein enriched in astrocytes|homolog of mouse MAT-1 oncogene|mammary transforming gene 1, mouse, homolog of|phosphoprotein enriched in astrocytes 15|phosphoprotein enriched in diabetes|proliferation and apoptosis adaptor 15

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PEA15, check out the PEA15 Infographic

PEA15 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PEA15: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15121

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PEA15 (NM_003768) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PEA15 (NM_003768) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PEA15 (NM_003768) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15121
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product