PCYT1B (NM_004845) Human Recombinant Protein

PCYT1B protein,

Recombinant protein of human phosphate cytidylyltransferase 1, choline, beta (PCYT1B)

Product Info Summary

SKU: PROTQ9Y5K3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PCYT1B (NM_004845) Human Recombinant Protein

View all PCYT1B recombinant proteins

SKU/Catalog Number

PROTQ9Y5K3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphate cytidylyltransferase 1, choline, beta (PCYT1B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PCYT1B (NM_004845) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y5K3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41.8 kDa

Amino Acid Sequence

MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK

Validation Images & Assay Conditions

Gene/Protein Information For PCYT1B (Source: Uniprot.org, NCBI)

Gene Name

PCYT1B

Full Name

Choline-phosphate cytidylyltransferase B

Weight

41.8 kDa

Superfamily

cytidylyltransferase family

Alternative Names

CCT B; CCTB; CCT-betaEC 2.7.7.15; choline-phosphate cytidylyltransferase B; CT B; CTB; CTP:phosphocholine cytidylyltransferase B; EC 2.7.7; phosphate cytidylyltransferase 1, choline, beta isoform; phosphate cytidylyltransferase 1, choline, beta; Phosphorylcholine transferase B PCYT1B CCTB, CTB phosphate cytidylyltransferase 1B, choline choline-phosphate cytidylyltransferase B|CCT B|CCT-beta|CT B|CTP:phosphocholine cytidylyltransferase b|CTP:phosphocholine cytidylyltransferase-beta|choline-phosphate cytidylyltransferase beta|phosphate cytidylyltransferase 1, choline, beta|phosphorylcholine transferase B|phosphorylcholine transferase beta

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PCYT1B, check out the PCYT1B Infographic

PCYT1B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PCYT1B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y5K3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PCYT1B (NM_004845) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PCYT1B (NM_004845) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PCYT1B (NM_004845) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y5K3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.