PCOLCE (NM_002593) Human Recombinant Protein

PCPE-1/PCOLCE protein,

Product Info Summary

SKU: PROTQ15113
Size: 20 µg
Source: HEK293T

Product Name

PCOLCE (NM_002593) Human Recombinant Protein

View all PCPE-1/PCOLCE recombinant proteins

SKU/Catalog Number

PROTQ15113

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human procollagen C-endopeptidase enhancer (PCOLCE)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PCOLCE (NM_002593) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15113)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

47.8 kDa

Amino Acid Sequence

MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGDVKGESGYVASEGFPNLYPPNKECIWTITVPEGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPLVAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIALTFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVLHRPNQDQILTNLSKRKCPSQPVRAAASQD

Validation Images & Assay Conditions

Gene/Protein Information For PCOLCE (Source: Uniprot.org, NCBI)

Gene Name

PCOLCE

Full Name

Procollagen C-endopeptidase enhancer 1

Weight

47.8 kDa

Alternative Names

PCOLCE; PCPE; PCPE1; PCPE-1; PCPE1Type I procollagen COOH-terminal proteinase enhancer; procollagen C-endopeptidase enhancer 1; procollagen C-endopeptidase enhancer; Procollagen COOH-terminal proteinase enhancer 1; Procollagen C-proteinase enhancer 1; procollagen, type 1, COOH-terminal proteinase enhancer; Type 1 procollagen C-proteinase enhancer protein PCOLCE PCPE, PCPE-1, PCPE1 procollagen C-endopeptidase enhancer procollagen C-endopeptidase enhancer 1|procollagen C-proteinase enhancer 1|procollagen COOH-terminal proteinase enhancer 1|procollagen, type 1, COOH-terminal proteinase enhancer|type 1 procollagen C-proteinase enhancer protein|type I procollagen COOH-terminal proteinase enhancer

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PCOLCE, check out the PCOLCE Infographic

PCOLCE infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PCOLCE: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15113

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PCOLCE (NM_002593) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PCOLCE (NM_002593) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PCOLCE (NM_002593) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15113
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.