Click image to see more details
Product Info Summary
| SKU: | A05478 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-HtrA3 Antibody Picoband®
SKU/Catalog Number
A05478
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-HtrA3 Antibody Picoband® catalog # A05478. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-HtrA3 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05478)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HtrA3, different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A05478 is reactive to HTRA3 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
49 kDa
Calculated molecular weight
48608 MW
Background of Htra3
Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A05478 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: PANC-1 whole Cell, HEPG2 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of HtrA3 using anti-HtrA3 antibody (A05478).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: PANC-1 whole Cell lysates,
Lane 2: HEPG2 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HtrA3 antigen affinity purified polyclonal antibody (Catalog # A05478) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for HtrA3 at approximately 49KD. The expected band size for HtrA3 is at 49KD.
Protein Target Info & Infographic
Gene/Protein Information For HTRA3 (Source: Uniprot.org, NCBI)
Gene Name
HTRA3
Full Name
Serine protease HTRA3
Weight
48608 MW
Superfamily
peptidase S1C family
Alternative Names
Serine protease HTRA3;3.4.21.-;High-temperature requirement factor A3;Pregnancy-related serine protease;HTRA3;PRSP; Htra3|2210021K23Rik, 9530081K03Rik, Prsp, Tasp|HtrA serine peptidase 3|serine protease HTRA3|high-temperature requirement factor A3|pregnancy-related serine protease|probable serine protease HTRA3|toll-associated serine protease
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on HTRA3, check out the HTRA3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for HTRA3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-HtrA3 Antibody Picoband® (A05478)
Hello CJ!
No publications found for A05478
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-HtrA3 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-HtrA3 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
3 Customer Q&As for Anti-HtrA3 Antibody Picoband®
Question
Is this A05478 anti-HtrA3 antibody reactive to the isotypes of HTRA3?
Verified Customer
Verified customer
Asked: 2020-03-03
Answer
The immunogen of A05478 anti-HtrA3 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human HtrA3 (330-362aa FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-03-03
Question
We are currently using anti-HtrA3 antibody A05478 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on monkey tissues as well?
Verified Customer
Verified customer
Asked: 2019-09-11
Answer
The anti-HtrA3 antibody (A05478) has not been validated for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-09-11
Question
Will anti-HtrA3 antibody A05478 work on feline WB with apex of heart?
Verified Customer
Verified customer
Asked: 2018-05-09
Answer
Our lab technicians have not validated anti-HtrA3 antibody A05478 on feline. You can run a BLAST between feline and the immunogen sequence of anti-HtrA3 antibody A05478 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline apex of heart in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-05-09
