Anti-HtrA3 Antibody Picoband™

Htra3 antibody

Boster Bio Anti-HtrA3 Antibody Picoband™ catalog # A05478. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A05478
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-HtrA3 Antibody Picoband™

View all Htra3 Antibodies

SKU/Catalog Number

A05478

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-HtrA3 Antibody Picoband™ catalog # A05478. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-HtrA3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05478)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human HtrA3, different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A05478 is reactive to Htra3 in Human

Applications

A05478 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

49 kDa

Calculated molecular weight

48608 MW

Background of Htra3

Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For Htra3 (Source: Uniprot.org, NCBI)

Gene Name

Htra3

Full Name

Serine protease HTRA3

Weight

48608 MW

Superfamily

peptidase S1C family

Alternative Names

EC 3.4.21; EC 3.4.21.-; EC 3.4.21.108; High-temperature requirement factor A3; HTRA 3; HtrA serine peptidase 3; HTRA3; Pregnancy-related serine protease; probable serine protease HTRA3; Prsp; serine protease HTRA3; Tasp Htra3|2210021K23Rik, 9530081K03Rik, Prsp, Tasp|HtrA serine peptidase 3|serine protease HTRA3|high-temperature requirement factor A3|pregnancy-related serine protease|probable serine protease HTRA3|toll-associated serine protease

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on Htra3, check out the Htra3 Infographic

Htra3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Htra3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A05478

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-HtrA3 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-HtrA3 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-HtrA3 Antibody Picoband™

Question

Is this A05478 anti-HtrA3 antibody reactive to the isotypes of HTRA3?

Verified Customer

Verified customer

Asked: 2020-03-03

Answer

The immunogen of A05478 anti-HtrA3 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human HtrA3 (330-362aa FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-03-03

Question

We are currently using anti-HtrA3 antibody A05478 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on monkey tissues as well?

Verified Customer

Verified customer

Asked: 2019-09-11

Answer

The anti-HtrA3 antibody (A05478) has not been validated for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-09-11

Question

Will anti-HtrA3 antibody A05478 work on feline WB with apex of heart?

Verified Customer

Verified customer

Asked: 2018-05-09

Answer

Our lab technicians have not validated anti-HtrA3 antibody A05478 on feline. You can run a BLAST between feline and the immunogen sequence of anti-HtrA3 antibody A05478 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline apex of heart in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-05-09

Order DetailsPrice
A05478

100μg

$370
A05478-10ug

10μg sample (liquid)

$99
A05478-Biotin

100 μg Biotin conjugated

$570
A05478-Cy3

100 μg Cy3 conjugated

$570
A05478-Dylight488

100 μg Dylight488 conjugated

$570
A05478-Dylight550

100 μg Dylight550 conjugated

$570
A05478-Dylight594

100 μg Dylight594 conjugated

$570
A05478-FITC

100 μg FITC conjugated

$570
A05478-HRP

100 μg HRP conjugated

$570
A05478-APC

100 μg APC conjugated

$670
A05478-PE

100 μg PE conjugated

$670
A05478-iFluor647

100 μg iFluor647 conjugated

$670
A05478-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A05478
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.