PAN3 (NM_175854) Human Recombinant Protein

Pan3 protein,

Recombinant protein of human PAN3 poly (A) specific ribonuclease subunit homolog (S. cerevisiae) (PAN3)

Product Info Summary

SKU: PROTQ58A45
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PAN3 (NM_175854) Human Recombinant Protein

View all Pan3 recombinant proteins

SKU/Catalog Number

PROTQ58A45

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human PAN3 poly (A) specific ribonuclease subunit homolog (S. cerevisiae) (PAN3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PAN3 (NM_175854) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ58A45)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

95.4 kDa

Amino Acid Sequence

MDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKYPLMQRMTNSSSSPSLLNDSAKPYSAHDPLTSPASSLFNDFGALNISQRRKTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQHEGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL

Validation Images & Assay Conditions

Gene/Protein Information For PAN3 (Source: Uniprot.org, NCBI)

Gene Name

PAN3

Full Name

PAN2-PAN3 deadenylation complex subunit Pan3

Weight

95.4 kDa

Superfamily

protein kinase superfamily

Alternative Names

hPan3; PAB-dependent poly(A)-specific ribonuclease subunit 3; PABP1-dependent poly A-specific ribonuclease subunit PAN3; PABP-dependent poly(A) nuclease 3; PAN3 poly(A) specific ribonuclease subunit homolog (S. cerevisiae); TS

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PAN3, check out the PAN3 Infographic

PAN3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PAN3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used PAN3 (NM_175854) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PAN3 (NM_175854) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PAN3 (NM_175854) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ58A45
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.