PAM16 (NM_016069) Human Recombinant Protein

Magmas protein,

Recombinant protein of humanmitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction (Magmas), nuclear gene encoding mitochondrial

Product Info Summary

SKU: PROTQ9Y3D7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PAM16 (NM_016069) Human Recombinant Protein

View all Magmas recombinant proteins

SKU/Catalog Number

PROTQ9Y3D7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of humanmitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction (Magmas), nuclear gene encoding mitochondrial

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PAM16 (NM_016069) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y3D7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.6 kDa

Amino Acid Sequence

MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT

Validation Images & Assay Conditions

Gene/Protein Information For PAM16 (Source: Uniprot.org, NCBI)

Gene Name

PAM16

Full Name

Mitochondrial import inner membrane translocase subunit TIM16

Weight

13.6 kDa

Superfamily

TIM16/PAM16 family

Alternative Names

MAGMAS; mitochondria associated protein involved in granulocyte macrophage colonystimulating factor signal transduction; Mitochondria-associated granulocyte macrophage CSF-signaling molecule; mitochondrial import inner membrane translocase subunit TIM16; presequence translocase-associated motor 16 homolog (S. cerevisiae); Presequence translocated-associated motor subunit PAM16; Tim16; TIMM16magmas-like protein PAM16 CGI-136, MAGMAS, SMDMDM, TIM16, TIMM16 presequence translocase associated motor 16 mitochondrial import inner membrane translocase subunit TIM16|magmas-like protein|mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction|mitochondria-associated granulocyte macrophage CSF-signaling molecule|presequence translocase associated motor 16 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PAM16, check out the PAM16 Infographic

PAM16 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PAM16: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y3D7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PAM16 (NM_016069) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PAM16 (NM_016069) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PAM16 (NM_016069) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y3D7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.