CHST10 (NM_004854) Human Recombinant Protein

Carbohydrate Sulfotransferase 10/CHST10 protein,

Product Info Summary

SKU: PROTO43529
Size: 20 µg
Source: HEK293T

Product Name

CHST10 (NM_004854) Human Recombinant Protein

View all Carbohydrate Sulfotransferase 10/CHST10 recombinant proteins

SKU/Catalog Number

PROTO43529

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human carbohydrate sulfotransferase 10 (CHST10)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CHST10 (NM_004854) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43529)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

42 kDa

Amino Acid Sequence

MHHQWLLLAACFWVIFMFMVASKFITLTFKDPDVYSAKQEFLFLTTMPEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIHWVTYVELCAPCEIMYSVIGHHETLEDDAPYILKEAGIDHLVSYPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQKPDFLLN

Validation Images & Assay Conditions

Gene/Protein Information For CHST10 (Source: Uniprot.org, NCBI)

Gene Name

CHST10

Full Name

Carbohydrate sulfotransferase 10

Weight

42 kDa

Superfamily

sulfotransferase 2 family

Alternative Names

Carbohydrate Sulfotransferase 10; CHST10; EC 2.8.2; HNK-1 sulfotransferase; HNK1ST; HNK-1STEC 2.8.2.-; HNK1STHuHNK-1ST; huHNK-1ST; MGC17148 CHST10 HNK-1ST, HNK1ST carbohydrate sulfotransferase 10 carbohydrate sulfotransferase 10|HNK-1 sulfotransferase|huHNK-1ST

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CHST10, check out the CHST10 Infographic

CHST10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CHST10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43529

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CHST10 (NM_004854) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CHST10 (NM_004854) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CHST10 (NM_004854) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43529
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.