p23 (PTGES3) (NM_006601) Human Recombinant Protein

p23/PTGES3 protein,

Product Info Summary

SKU: PROTQ15185
Size: 20 µg
Source: HEK293T

Product Name

p23 (PTGES3) (NM_006601) Human Recombinant Protein

View all p23/PTGES3 recombinant proteins

SKU/Catalog Number

PROTQ15185

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human prostaglandin E synthase 3 (cytosolic) (PTGES3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

p23 (PTGES3) (NM_006601) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15185)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.5 kDa

Amino Acid Sequence

MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Validation Images & Assay Conditions

Gene/Protein Information For PTGES3 (Source: Uniprot.org, NCBI)

Gene Name

PTGES3

Full Name

Prostaglandin E synthase 3

Weight

18.5 kDa

Superfamily

p23/wos2 family

Alternative Names

CPGES; cPGESp23; Cytosolic prostaglandin E2 synthase; Hsp90 co-chaperone; p23; P23cytosolic prostaglandin E synthase; Progesterone receptor complex p23; prostaglandin E synthase 3 (cytosolic); prostaglandin E synthase 3; PTGES3; TEBP; TEBPEC 5.3.99.3; Telomerase-binding protein p23; unactive progesterone receptor, 23 kD PTGES3 P23, TEBP, cPGES prostaglandin E synthase 3 prostaglandin E synthase 3|Hsp90 co-chaperone|cytosolic prostaglandin E synthase|cytosolic prostaglandin E2 synthase|progesterone receptor complex p23|prostaglandin E synthase 3 (cytosolic)|telomerase-binding protein p23|unactive progesterone receptor, 23 kD

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PTGES3, check out the PTGES3 Infographic

PTGES3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PTGES3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15185

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used p23 (PTGES3) (NM_006601) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For p23 (PTGES3) (NM_006601) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for p23 (PTGES3) (NM_006601) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15185
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.