p18 INK4c (CDKN2C) (NM_001262) Human Recombinant Protein

p18INK4c/CDKN2C protein,

Product Info Summary

SKU: PROTP42773
Size: 20 µg
Source: HEK293T

Product Name

p18 INK4c (CDKN2C) (NM_001262) Human Recombinant Protein

View all p18INK4c/CDKN2C recombinant proteins

SKU/Catalog Number

PROTP42773

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

p18 INK4c (CDKN2C) (NM_001262) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP42773)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.9 kDa

Amino Acid Sequence

MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

Validation Images & Assay Conditions

Gene/Protein Information For CDKN2C (Source: Uniprot.org, NCBI)

Gene Name

CDKN2C

Full Name

Cyclin-dependent kinase 4 inhibitor C

Weight

17.9 kDa

Superfamily

CDKN2 cyclin-dependent kinase inhibitor family

Alternative Names

CDK6 inhibitor p18; CDKN2C; CDKN6; cyclin-dependent inhibitor; cyclin-dependent kinase 4 inhibitor C; Cyclin-dependent kinase 6 inhibitor; cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4); INK4Ccyclin-dependent kinase 6 inhibitor p18; p18; p18INK4c; p18-INK4C; p18-INK6 CDKN2C INK4C, p18, p18-INK4C cyclin dependent kinase inhibitor 2C cyclin-dependent kinase 4 inhibitor C|CDK6 inhibitor p18|cyclin-dependent inhibitor|cyclin-dependent kinase 6 inhibitor p18|cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)|p18-INK6

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDKN2C, check out the CDKN2C Infographic

CDKN2C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDKN2C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP42773

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used p18 INK4c (CDKN2C) (NM_001262) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For p18 INK4c (CDKN2C) (NM_001262) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for p18 INK4c (CDKN2C) (NM_001262) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP42773
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.