p15 INK4b (CDKN2B) (NM_004936) Human Recombinant Protein

p15INK4b/CDKN2B protein,

Recombinant protein of human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1

Product Info Summary

SKU: PROTP42772
Size: 20 µg
Source: HEK293T

Product Name

p15 INK4b (CDKN2B) (NM_004936) Human Recombinant Protein

View all p15INK4b/CDKN2B recombinant proteins

SKU/Catalog Number

PROTP42772

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

p15 INK4b (CDKN2B) (NM_004936) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP42772)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.5 kDa

Amino Acid Sequence

MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD

Validation Images & Assay Conditions

Gene/Protein Information For CDKN2B (Source: Uniprot.org, NCBI)

Gene Name

CDKN2B

Full Name

Cyclin-dependent kinase 4 inhibitor B

Weight

14.5 kDa

Superfamily

CDKN2 cyclin-dependent kinase inhibitor family

Alternative Names

CDK4I; CDKN2B; cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4); cyclin-dependent kinases 4 and 6 binding protein; INK4BCDK4B inhibitor; MTS2; MTS-2; MTS2CDK inhibitory protein; Multiple tumor suppressor 2; p14_CDK inhibitor; p14_INK4B; p14-INK4b; p15 CDK inhibitor; p15_INK4B; P15cyclin-dependent kinase 4 inhibitor B; p15INK4b; p15-INK4b; TP15 CDKN2B CDK4I, INK4B, MTS2, P15, TP15, p15INK4b cyclin dependent kinase inhibitor 2B cyclin-dependent kinase 4 inhibitor B|CDK inhibitory protein|CDK4B inhibitor|MTS-2|cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)|cyclin-dependent kinases 4 and 6 binding protein|multiple tumor suppressor 2|p14-INK4b|p14_CDK inhibitor|p14_INK4B|p15 CDK inhibitor|p15-INK4b|p15_INK4B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDKN2B, check out the CDKN2B Infographic

CDKN2B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDKN2B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP42772

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used p15 INK4b (CDKN2B) (NM_004936) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For p15 INK4b (CDKN2B) (NM_004936) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for p15 INK4b (CDKN2B) (NM_004936) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP42772
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.