OTUD6B (NM_016023) Human Recombinant Protein

OTUD6B protein,

Recombinant protein of human OTU domain containing 6B (OTUD6B)

Product Info Summary

SKU: PROTQ8N6M0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

OTUD6B (NM_016023) Human Recombinant Protein

View all OTUD6B recombinant proteins

SKU/Catalog Number

PROTQ8N6M0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human OTU domain containing 6B (OTUD6B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

OTUD6B (NM_016023) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N6M0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.1 kDa

Amino Acid Sequence

MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENCS

Validation Images & Assay Conditions

Gene/Protein Information For OTUD6B (Source: Uniprot.org, NCBI)

Gene Name

OTUD6B

Full Name

Deubiquitinase OTUD6B

Weight

37.1 kDa

Alternative Names

CGI-77; DUBA5DUBA-5; OTU domain containing 6B; OTU domain-containing protein 6B OTUD6B CGI-77, DUBA-5, DUBA5, IDDFSDA OTU deubiquitinase 6B deubiquitinase OTUD6B|OTU domain containing 6B|OTU domain-containing protein 6B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on OTUD6B, check out the OTUD6B Infographic

OTUD6B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for OTUD6B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N6M0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used OTUD6B (NM_016023) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For OTUD6B (NM_016023) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for OTUD6B (NM_016023) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N6M0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product