OSCP1 (NM_145047) Human Recombinant Protein

NOR1/OSCP1 protein,

Recombinant protein of human chromosome 1 open reading frame 102 (C1orf102), transcript variant 1

Product Info Summary

SKU: PROTQ8WVF1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

OSCP1 (NM_145047) Human Recombinant Protein

View all NOR1/OSCP1 recombinant proteins

SKU/Catalog Number

PROTQ8WVF1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 1 open reading frame 102 (C1orf102), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

OSCP1 (NM_145047) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WVF1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

43.1 kDa

Amino Acid Sequence

MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSPTILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSMFLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFNNKGEEVKRIEFKHGGNYVPAPKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLASWTQESIAPNPLAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRPEELSYEVINIQATQDQQRSEELARIMGEFEITEQPRLSTSKGDDLLAMMDEL

Validation Images & Assay Conditions

Gene/Protein Information For OSCP1 (Source: Uniprot.org, NCBI)

Gene Name

OSCP1

Full Name

Protein OSCP1

Weight

43.1 kDa

Alternative Names

C1orf102; NOR1; OSCP1 organic solute carrier partner 1 OSCP1 C1orf102, NOR1 organic solute carrier partner 1 protein OSCP1|organic solute carrier protein 1|organic solute transport protein 1|oxidored nitro domain containing protein|oxidored-nitro domain-containing protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on OSCP1, check out the OSCP1 Infographic

OSCP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for OSCP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WVF1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used OSCP1 (NM_145047) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For OSCP1 (NM_145047) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for OSCP1 (NM_145047) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WVF1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.