Plunc (BPIFA1) (NM_016583) Human Recombinant Protein

PLUNC protein,

Product Info Summary

SKU: PROTQ9NP55
Size: 20 µg
Source: HEK293T

Product Name

Plunc (BPIFA1) (NM_016583) Human Recombinant Protein

View all PLUNC recombinant proteins

SKU/Catalog Number

PROTQ9NP55

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human palate, lung and nasal epithelium associated (PLUNC), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Plunc (BPIFA1) (NM_016583) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NP55)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.6 kDa

Amino Acid Sequence

MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV

Validation Images & Assay Conditions

Gene/Protein Information For BPIFA1 (Source: Uniprot.org, NCBI)

Gene Name

BPIFA1

Full Name

BPI fold-containing family A member 1

Weight

24.6 kDa

Superfamily

BPI/LBP/Plunc superfamily

Alternative Names

bA49G10.5; BPIFA1; ligand-binding protein RYA3; LPLUNC3; Lung-specific protein X; LUNX; LUNXNASG; Nasopharyngeal carcinoma-related protein; Palate lung and nasal epithelium clone protein; palate, lung and nasal epithelium associated; palate, lung and nasal epithelium carcinoma associated; PLUNC; protein Plunc; Secretory protein in upper respiratory tracts; SPLUNC1; SPLUNC1SPURT; tracheal epithelium enriched protein; Tracheal epithelium-enriched protein; Von Ebner protein Hl Bpifa1|LUNX, NASG, Pl, Plunc, SPL, SPLUNC1, SPURT|BPI fold containing family A, member 1|BPI fold-containing family A member 1|palate lung and nasal epithelium clone protein|palate, lung, and nasal epithelium associated|palate, lung, and nasal epithelium clone|palate, lung, and nasal epithelium expressed transcript|protein Plunc

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BPIFA1, check out the BPIFA1 Infographic

BPIFA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BPIFA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NP55

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Plunc (BPIFA1) (NM_016583) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Plunc (BPIFA1) (NM_016583) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Plunc (BPIFA1) (NM_016583) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NP55
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.