ORC4L (ORC4) (NM_002552) Human Recombinant Protein

ORC4L protein,

Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 2

Product Info Summary

SKU: PROTO43929
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ORC4L (ORC4) (NM_002552) Human Recombinant Protein

View all ORC4L recombinant proteins

SKU/Catalog Number

PROTO43929

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ORC4L (ORC4) (NM_002552) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43929)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

50.2 kDa

Amino Acid Sequence

MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL

Validation Images & Assay Conditions

Gene/Protein Information For ORC4 (Source: Uniprot.org, NCBI)

Gene Name

ORC4

Full Name

Origin recognition complex subunit 4

Weight

50.2 kDa

Superfamily

ORC4 family

Alternative Names

HsORC4; ORC4LFLJ46668; ORC4P; origin recognition complex subunit 4; origin recognition complex, subunit 4 (yeast homolog)-like; origin recognition complex, subunit 4 homolog (S. cerevisiae); origin recognition complex, subunit 4 homolog; origin recognition complex, subunit 4; origin recognition complex, subunit 4-like (S. cerevisiae); origin recognition complex, subunit 4-like (yeast); origin recognition complex, subunit 4-like ORC4 ORC4LP, ORC4 origin recognition complex subunit 4 origin recognition complex subunit 4|origin recognition complex, subunit 4 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ORC4, check out the ORC4 Infographic

ORC4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ORC4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43929

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ORC4L (ORC4) (NM_002552) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ORC4L (ORC4) (NM_002552) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ORC4L (ORC4) (NM_002552) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43929
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.