OPA3 (NM_025136) Human Recombinant Protein

OPA3 protein,

Recombinant protein of human optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), transcript variant 2

Product Info Summary

SKU: PROTQ9H6K4
Size: 20 µg
Source: HEK293T

Product Name

OPA3 (NM_025136) Human Recombinant Protein

View all OPA3 recombinant proteins

SKU/Catalog Number

PROTQ9H6K4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

OPA3 (NM_025136) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H6K4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.8 kDa

Amino Acid Sequence

MVVGAFPMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK

Validation Images & Assay Conditions

Gene/Protein Information For OPA3 (Source: Uniprot.org, NCBI)

Gene Name

OPA3

Full Name

Optic atrophy 3 protein

Weight

19.8 kDa

Superfamily

OPA3 family

Alternative Names

FLJ22187; FLJ25932; MGA3Optic atrophy 3 (Iraqi-Jewish 'optic atrophy plus'); MGC75494; optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia); optic atrophy 3 protein OPA3 MGA3 outer mitochondrial membrane lipid metabolism regulator OPA3 optic atrophy 3 protein|OPA3 outer mitochondrial membrane lipid metabolism regulator|Optic atrophy 3 (Iraqi-Jewish optic atrophy plus)|optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on OPA3, check out the OPA3 Infographic

OPA3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for OPA3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H6K4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used OPA3 (NM_025136) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For OPA3 (NM_025136) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for OPA3 (NM_025136) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H6K4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.